Protein Info for MPMX26_00308 in Acinetobacter radioresistens SK82

Annotation: Heme chaperone HemW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 TIGR00539: putative oxygen-independent coproporphyrinogen III oxidase" amino acids 1 to 360 (360 residues), 363.1 bits, see alignment E=8.1e-113 PF04055: Radical_SAM" amino acids 1 to 171 (171 residues), 85.1 bits, see alignment E=6.5e-28 PF06969: HemN_C" amino acids 295 to 359 (65 residues), 38.5 bits, see alignment E=9.9e-14

Best Hits

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 77% identity to abc:ACICU_00406)

Predicted SEED Role

"Radical SAM family enzyme, similar to coproporphyrinogen III oxidase, oxygen-independent, clustered with nucleoside-triphosphatase RdgB" in subsystem Heat shock dnaK gene cluster extended or Heme and Siroheme Biosynthesis or Queuosine-Archaeosine Biosynthesis

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.99.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (368 amino acids)

>MPMX26_00308 Heme chaperone HemW (Acinetobacter radioresistens SK82)
MPWCVRKCPYCDFNSHAVPDGKLSLELEQEYLQALVEDFKTQLHFAQGRKLHSIFIGGGT
PSLISASGYQWLFQQLNGLLPFEEQCEITLEANPGTVEHDPFAGYLAAGINRLSIGVQTF
NEQHLKQLGRIHSAENAINAIHQAQEAGFKRINIDLMHGLPQQTLEQALTDLRMAVENGA
THISWYQLTIEPNTVFFRTQPVLPVENVLEHIQEQGEAYLKAHGFIQYEISAWRKEEPSA
HNMNYWQFGDYLAIGAGAHAKVSLQDGVYRFQKTRLPKDYLAKIPAEHLQFKKIEPEDMP
FEFMMNALRLNEGVPARFYNERTGYELEKIQPKLDSLRQRHLFSENTEQLACTAHGHLFL
NSVLEEFL