Protein Info for MPMX26_00303 in Acinetobacter radioresistens SK82

Annotation: Putative fluoride ion transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 126 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 53 (19 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 98 to 122 (25 residues), see Phobius details PF02537: CRCB" amino acids 4 to 116 (113 residues), 97.6 bits, see alignment E=2.6e-32 TIGR00494: protein CrcB" amino acids 4 to 118 (115 residues), 89.2 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 47% identical to CRCB_THET8: Putative fluoride ion transporter CrcB (crcB) from Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)

KEGG orthology group: K06199, CrcB protein (inferred from 47% identity to swi:Swit_2709)

Predicted SEED Role

"Protein crcB homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (126 amino acids)

>MPMX26_00303 Putative fluoride ion transporter CrcB (Acinetobacter radioresistens SK82)
MNWLLVACGGAIGASLRYGITLSLSQTGSLFPWATWWINLLGCFCAGIFFAISQKYAVLQ
QETRLFLMVGILGGFTTFSSFGLETFQLLRQNEIAMGLAYSLSSLIMGVLLLTAGFYLFQ
YLLCNR