Protein Info for MPMX26_00287 in Acinetobacter radioresistens SK82

Annotation: Magnesium and cobalt efflux protein CorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF00571: CBS" amino acids 58 to 113 (56 residues), 29.1 bits, see alignment E=1e-10 amino acids 125 to 179 (55 residues), 31.7 bits, see alignment E=1.6e-11 PF03471: CorC_HlyC" amino acids 206 to 277 (72 residues), 52.2 bits, see alignment E=5e-18

Best Hits

Swiss-Prot: 41% identical to CORC_HAEIN: Magnesium and cobalt efflux protein CorC (corC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06189, magnesium and cobalt transporter (inferred from 91% identity to aci:ACIAD0416)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>MPMX26_00287 Magnesium and cobalt efflux protein CorC (Acinetobacter radioresistens SK82)
MHEESGPSWGMRGLRKWLGTAPGTRDELLKLVQDSRRFLEPDTVAMLEGVLDLPATKVRE
VMTPRTAIISLQEDDQLLDILHVLIESAHSRFPVFSSDQPDNVVGILLAKDLLPFMTTPT
PKIDVRALMRQPLFVPESARSDQVLRMLKNTQTHIAIVIDEYGSTSGLVTLEDILEEIVG
EIEDEHDKIDEEAQYIIPDQTHSTANAWIVQALTPIEHFNTVLDADFSDDEVETVGGLLL
QEIGLVSDLQGQVIELGDWEFSIVEADARTIHLIRAVRK