Protein Info for MPMX26_00283 in Acinetobacter radioresistens SK82

Annotation: Type II secretion system protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 167 to 190 (24 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 368 to 395 (28 residues), see Phobius details TIGR02120: type II secretion system protein F" amino acids 4 to 401 (398 residues), 480.3 bits, see alignment E=2.9e-148 PF00482: T2SSF" amino acids 70 to 191 (122 residues), 107.5 bits, see alignment E=2.4e-35 amino acids 271 to 393 (123 residues), 104.1 bits, see alignment E=2.6e-34

Best Hits

Swiss-Prot: 51% identical to GSPF_PSEAE: Type II secretion system protein F (xcpS) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02455, general secretion pathway protein F (inferred from 85% identity to aci:ACIAD0411)

Predicted SEED Role

"General secretion pathway protein F"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>MPMX26_00283 Type II secretion system protein F (Acinetobacter radioresistens SK82)
MPAYQFTAMDASGKQQKGILEGDSARQIRQQLRDKTWIPVSVEPVENKEKGQTRSWRKKG
LNAYDLALMTRQLSVLVAAAIPLEEAIRAVGKQSEKVHVQNLLMSVRSKVLEGHSLAQAI
QQSGRFPDLYIATIAAGERSGHLDLILDQLADYTENRFAMQKKIQGAMVYPIILMLMSFA
IVMGLMTYVVPDIVKTFDQSKQALPAITVILMKTSDFIRQAWPFLLVISVVGIMLLIRFL
KTSAGHYTFDRFVLKLPLFGKLARGINAARFASTLSILTRSGVPLVDALKIGAAVSNNWV
IRDSVNLAAEKVTEGGNLATQLERAGYFPPMMVQMIRSGEASGELDRMLERASTMQDREV
ATFISTLLALLEPLMLVVMAGIVLVIVIAVMLPIVNMNNMV