Protein Info for MPMX26_00282 in Acinetobacter radioresistens SK82

Annotation: Primosomal protein N'

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 741 PF17764: PriA_3primeBD" amino acids 15 to 114 (100 residues), 83.1 bits, see alignment E=3.2e-27 PF04851: ResIII" amino acids 207 to 369 (163 residues), 65 bits, see alignment E=2.4e-21 PF00270: DEAD" amino acids 210 to 371 (162 residues), 75.8 bits, see alignment E=1.1e-24 TIGR00595: primosomal protein N'" amino acids 230 to 737 (508 residues), 620.4 bits, see alignment E=1.2e-190 PF18319: Zn_ribbon_PriA" amino acids 454 to 478 (25 residues), 19.1 bits, see alignment (E = 3.2e-07) PF00271: Helicase_C" amino acids 506 to 597 (92 residues), 24 bits, see alignment E=1.2e-08 PF18074: PriA_C" amino acids 642 to 737 (96 residues), 81.1 bits, see alignment E=2.6e-26

Best Hits

KEGG orthology group: K04066, primosomal protein N' (replication factor Y) (superfamily II helicase) [EC: 3.6.4.-] (inferred from 77% identity to abb:ABBFA_003168)

Predicted SEED Role

"Helicase PriA essential for oriC/DnaA-independent DNA replication" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or DNA-replication

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.-

Use Curated BLAST to search for 3.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (741 amino acids)

>MPMX26_00282 Primosomal protein N' (Acinetobacter radioresistens SK82)
MPSSSHNNCCIYRVRVAVPVHLYDSFDYLLSAEQYLQAEVGARVAVSFGRQNLIGIIVEK
ISPDVMPDPRIKLKAITELLDKEAIIDSKVLSLLTWSAQYYQFPLGEVMQCALPGLLRQG
KPLNLLARVWKVVQPDAEQLLKRSIKQQDAYKILKLHAAGTTEDILNLSGVETATLKALE
KKEIVRCELTAINTTPEPVQLAQMPLTPNEDQHKAIQRILKSLKKFQAFLLDGLTGSGKT
EVYLQVMYEVLKQGKQILVLVPEIGLTPQTISRFKSRFNVDIVLLHSGLSESKRLQAWQH
AQTGKASIILGTRSAIYTSLPRLGLIILDEEHDLSFKQQEGFRYHARDVALYRAHLENCP
IILGSATPSLDSYHLVEQNKLTRLELNQRAGNAVLPKMQLIDLKVAKKQHGISEQLIKQI
QQRLDKKEQVLVFLNRRGYAPVLVCNHCGWQANCPHCDAHFTLHTQPYNHLHCHHCGSIH
RVPESCPECQQTTLKTLGMGTAKVEETLTELFPDFDVIRVDRDSTSRVGQWDRIYQRIHQ
SQPAILLGTQMLAKGHHFPYVTLVAILDIDAGLLSFDFRAPERTAQLIIQVAGRAGRGDR
RGEVYLQTLRPDHPLLTTLIEKDYRAFAKQALIERQQAQLPPYRYTVLVRADSRNQQYSQ
EFLAEIARKLRELAGSQVDIWGPIPAPMERKAGRYRAHLVLLSADRAQLHFYLRQWWAMV
VQQPRQHQLKLSIDVDPQELS