Protein Info for MPMX26_00281 in Acinetobacter radioresistens SK82

Annotation: Glutathione-regulated potassium-efflux system protein KefC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 51 to 71 (21 residues), see Phobius details amino acids 83 to 106 (24 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 234 to 252 (19 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 14 to 368 (355 residues), 144.7 bits, see alignment E=5.4e-46 PF02254: TrkA_N" amino acids 398 to 508 (111 residues), 78.3 bits, see alignment E=9e-26 PF27452: KefB_C" amino acids 516 to 586 (71 residues), 37.7 bits, see alignment E=3e-13

Best Hits

KEGG orthology group: K11747, glutathione-regulated potassium-efflux system protein KefB (inferred from 48% identity to acd:AOLE_17595)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system protein KefB" in subsystem Glutathione-regulated potassium-efflux system and associated functions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>MPMX26_00281 Glutathione-regulated potassium-efflux system protein KefC (Acinetobacter radioresistens SK82)
MSLMLYMTIFLGASLILVALSRRLGLTSVLGYLVTGLILGQSGFNLIEFSLIQNFIDYAS
ILLVFLIGLELRPQRIWLMRSHLIKLGGIQIVITAGLIVTLGITVLQLPLLNSFIVGFAL
ALSAMILALQLQTQYEQLNTTTGQYTLAVTLAQALVAIFLIALLPLFTRTESSQHGIAYF
AATLATISGVFLFGRYLIQPFLNYLAKQNSIELMAATALFTVLAIFLTVDALGLHVLIGA
LLAGMLLADTPFRHAFETMIKPFRSLMSGFFFLSLGLYASFAVITQSPVFIVSLVAALLI
IKSIVLAVLGHYSRLNWSNASLLGLGLFQSGELTFLVLYAALKEQLIEQVLMNQLTAVII
LSMLLSPFIYLLAQHIIKQRPEQTRQDNVNTEASPALIIAGFGRFGQIIARVAHQQRLPF
TIIDNNQPGAEFIEAYGGRFIEADITDSQTLQQAGIEQAKILVIAIDDVEDCMNAVRYIR
LNYPELKLLVRARDRYHVHLLRDMGIEHFWRETQLSALDMAEYMLHAHGLSLEEAHEQVD
AFRQHDLILLKQQQRLNRDDHKIYETHGNALAELKHLFAYNEQVQARYEESDLNPNVENY
RSDVTQGGQN