Protein Info for MPMX26_00267 in Acinetobacter radioresistens SK82

Annotation: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01209: Ubie_methyltran
  • amino acids 83 to 313 (231 residues), 332.6 bits, E=4.1e-103
• TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase
  • amino acids 88 to 313 (226 residues), 276.5 bits, E=6.7e-87
• PF01135: PCMT
  • amino acids 123 to 231 (109 residues), 24.4 bits, E=8e-09
• PF13489: Methyltransf_23
  • amino acids 125 to 295 (171 residues), 52.7 bits, E=1.5e-17
• PF13847: Methyltransf_31
  • amino acids 126 to 292 (167 residues), 81.5 bits, E=2e-26
• PF13649: Methyltransf_25
  • amino acids 130 to 227 (98 residues), 75.5 bits, E=1.6e-24
• PF08242: Methyltransf_12
  • amino acids 131 to 229 (99 residues), 52.2 bits, E=2.9e-17
• PF08241: Methyltransf_11
  • amino acids 131 to 231 (101 residues), 71.2 bits, E=3.3e-23

Best Hits

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 88% identity to abc:ACICU_00364)

Predicted SEED Role

No annotation

MetaCyc Pathways

• menaquinol-4 biosynthesis I (1/1 steps found)
• menaquinol-6 biosynthesis (1/1 steps found)
• menaquinol-8 biosynthesis (1/1 steps found)
• menaquinol-9 biosynthesis (1/1 steps found)
• menaquinol-10 biosynthesis (1/2 steps found)
• menaquinol-11 biosynthesis (1/2 steps found)
• menaquinol-12 biosynthesis (1/2 steps found)
• menaquinol-13 biosynthesis (1/2 steps found)
• menaquinol-7 biosynthesis (1/2 steps found)
• superpathway of menaquinol-8 biosynthesis III (2/9 steps found)
• superpathway of menaquinol-8 biosynthesis I (2/10 steps found)
• superpathway of menaquinol-8 biosynthesis II (2/10 steps found)
• superpathway of menaquinol-9 biosynthesis (2/10 steps found)
• superpathway of menaquinol-10 biosynthesis (1/10 steps found)
• superpathway of menaquinol-11 biosynthesis (1/10 steps found)
• superpathway of menaquinol-12 biosynthesis (1/10 steps found)
• superpathway of menaquinol-13 biosynthesis (1/10 steps found)
• superpathway of menaquinol-6 biosynthesis (1/10 steps found)
• superpathway of menaquinol-7 biosynthesis (1/10 steps found)
• superpathway of chorismate metabolism (36/59 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163

Protein Sequence (314 amino acids)

>MPMX26_00267 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (Acinetobacter radioresistens SK82)
MSNENPTSSPATESVSNTEKVSPFLTEPLPQGAPQGQQQSLQQQLTDASTNTQVPKYNLP
RGANTGNVGEVTHFGYKSVRAEDKAQKVAEVFHSVASKYDVMNDLMSFGIHRLWKRFAIN
MSGVRRGQHVLDIAGGTGDLAKVFSREVGPTGHVVLSDINESMLNVGRDRLLDAGCTNVD
FVLANAETLEPFADNSFDLLTISFGLRNVTDKDAALQAMYRVLKPGGRLLILEFSKPVFE
PFSKLYDLYSFTALPLMGKLVANDSESYKYLAESIRMHPDQRTLKTMMENAGFQNCDYHN
LTGGIVAVHRGFKL