Protein Info for MPMX26_00265 in Acinetobacter radioresistens SK82

Annotation: putative protein kinase UbiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03109: ABC1
  • amino acids 94 to 339 (246 residues), 226.6 bits, E=1.3e-71

Best Hits

Swiss-Prot: 40% identical to UBIB_HAHCH: Probable protein kinase UbiB (ubiB) from Hahella chejuensis (strain KCTC 2396)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 88% identity to aci:ACIAD0382)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (8/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (4/8 steps found)
• superpathway of chorismate metabolism (36/59 steps found)

Protein Sequence (539 amino acids)

>MPMX26_00265 putative protein kinase UbiB (Acinetobacter radioresistens SK82)
MIPHVTRLLELWRITAHYRLDTLVPAEEIPVKARPVLNLIRLHPAAWSSKERKNPLKLKE
ALEDMGPLAIKLGQLLSTRRDLIPPEILAQLVLLQDRVKPFPVEVAKSRIQQSLRADIYT
LFARFDEQPLAAASIAQVHTAALHDGREVVVKVTRPDIRVQILQDFEILAWLGHWLESRI
EAARALHLSEIIQDYRQIILNELDLTLEADNTRRMRHYFTGSSMMYVPEVYMDSPDVMVA
ERITGVPISDTATFDRMGMDRADLAEKGLTIFFTQVFRDNFFHADMHPGNVFVETINPQN
PRFIALDCAIMGELSKHDQMTVARMLLAVMNSNFMQLIQIVHQAGWIPPGTDQDALAREM
RRTVGPMVSKPMDQLDFAGILIQVMDIARRFHLEIPPQLMLLLKTLVHVEGLGTDLYPQL
DIWKLAKPILTDWIKANMHPVKNIKEIGQQIPDLLLGAQDLPSLLIDSLNGLKNQSSWHE
KQLRELQGMRLQIEHQQRRSWIFGSLIAIFLSIAIIAPWYLSVLLIAFASFLALWRVVK