Protein Info for MPMX26_00241 in Acinetobacter radioresistens SK82

Annotation: 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00186: RNA methyltransferase, TrmH family, group 3
  • amino acids 5 to 246 (242 residues), 223.8 bits, E=1.1e-70
• PF08032: SpoU_sub_bind
  • amino acids 7 to 80 (74 residues), 68.2 bits, E=6.6e-23
• PF00588: SpoU_methylase
  • amino acids 98 to 240 (143 residues), 139.7 bits, E=7.4e-45

Best Hits

Swiss-Prot: 87% identical to RLMB_ACIAD: 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (rlmB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K03218, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 90% identity to acd:AOLE_17810)

MetaCyc: 50% identical to 23S rRNA 2'-O-ribose G2251 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11588 [EC: 2.1.1.185]

Predicted SEED Role

"23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.185

Protein Sequence (251 amino acids)

>MPMX26_00241 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB (Acinetobacter radioresistens SK82)
MAKPEYYYGVHAVESLLELEPERVLTLFTLKGREDQRLQKILELAEPFGISVQKASRDSL
EKLAGLPFHQGVVAAVRPHPVMNEKDLEQLLEQTPDVLLLALDQVTDPHNLGACIRTAAA
MGVQAVIVPRDRSASLTPTARKVAAGGAEKVKFIQVTNLARTLAQMKEHSQVRVIGTMLD
EQALPLQQCDLTGPIVIVMGAEDTGLRPITQAQCDHKVYIPMAGNLQSLNVSVATGMALY
EACRQRNAKSL