Protein Info for MPMX26_00237 in Acinetobacter radioresistens SK82

Annotation: Putative pre-16S rRNA nuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03652: RuvX
  • amino acids 10 to 140 (131 residues), 131.6 bits, E=1.2e-42
• TIGR00250: putative transcription antitermination factor YqgF
  • amino acids 11 to 139 (129 residues), 112.7 bits, E=6.5e-37

Best Hits

Swiss-Prot: 78% identical to YQGF_ACIAD: Putative pre-16S rRNA nuclease (ACIAD0352) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K07447, putative holliday junction resolvase [EC: 3.1.-.-] (inferred from 78% identity to aci:ACIAD0352)

MetaCyc: 46% identical to ribonuclease H-like domain-containing nuclease (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Putative Holliday junction resolvase YqgF"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.- or 3.1.11.1

Protein Sequence (147 amino acids)

>MPMX26_00237 Putative pre-16S rRNA nuclease (Acinetobacter radioresistens SK82)
MPDASHPGLIMAFDFGTQKMGMAIGQAAIQSANPLTLFPMKDGIPNWEHLLKIVKEWQPD
LFLVGLPLNMDESESELSARARKFARRLRHQTNIETLMVDERLTTREARSELSQYQAQGG
NRKLAADSIAAALLIESWYREPDGLKP