Protein Info for MPMX26_00207 in Acinetobacter radioresistens SK82

Annotation: Transcription termination/antitermination protein NusG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02357: NusG
  • amino acids 2 to 106 (105 residues), 107.6 bits, E=2e-35
• TIGR00922: transcription termination/antitermination factor NusG
  • amino acids 4 to 175 (172 residues), 207.2 bits, E=8e-66

Best Hits

Swiss-Prot: 70% identical to NUSG_PSEAE: Transcription termination/antitermination protein NusG (nusG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02601, transcriptional antiterminator NusG (inferred from 97% identity to aci:ACIAD0301)

Predicted SEED Role

"Transcription antitermination protein NusG" in subsystem Transcription factors bacterial

Protein Sequence (177 amino acids)

>MPMX26_00207 Transcription termination/antitermination protein NusG (Acinetobacter radioresistens SK82)
MKRWYIIHAYSGYEKQVMRSLNDRIQRSAVADSFGEVLVPTEEVVEMKDGKKRKSERKFF
PGYVLVEMEMNDETWHIVKECPKVLGFIGGTAEKPAPITQREADAILARVRNTGEAPRPK
TMFEPGEELLVIDGPFTDFKGVVEEVLYEKSRLTLTINVFNRPTQVELEFRQVEKSV