Protein Info for MPMX26_00198 in Acinetobacter radioresistens SK82

Annotation: Phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00702: Hydrolase" amino acids 11 to 189 (179 residues), 98.3 bits, see alignment E=1.5e-31 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 12 to 221 (210 residues), 194.5 bits, see alignment E=2.4e-61 PF13419: HAD_2" amino acids 12 to 195 (184 residues), 128.9 bits, see alignment E=5e-41 PF12710: HAD" amino acids 12 to 186 (175 residues), 36.4 bits, see alignment E=1.5e-12 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 107 to 189 (83 residues), 35.1 bits, see alignment E=2.4e-12 PF13242: Hydrolase_like" amino acids 151 to 220 (70 residues), 49.6 bits, see alignment E=6e-17

Best Hits

Swiss-Prot: 42% identical to GPH_NITOC: Phosphoglycolate phosphatase (Noc_2493) from Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 66% identity to abc:ACICU_00294)

Predicted SEED Role

"Phosphoglycolate phosphatase (EC 3.1.3.18)" in subsystem 2-phosphoglycolate salvage or Glycolate, glyoxylate interconversions or Photorespiration (oxidative C2 cycle) (EC 3.1.3.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>MPMX26_00198 Phosphoglycolate phosphatase (Acinetobacter radioresistens SK82)
MTVAQLTTRNLILFDLDGTLVDSATDLFRAMNISLNTLQLPMVTEQQIRQWVGKGASKLC
EDVLLNLLGEVEPSQHQQLYAEFLEVYAAGICVDSKPFPGVIDFLDYAVRQNITLACVTN
KPQKLAEALLYELRLDQYFKLVVGGDSLEHKKPHPLPLLHCMDVLKSNTKQTLLIGDSSN
DIEAARRAGVDCIVVSYGYNHGEDIHDSAPQQVVDDLRELIDH