Protein Info for MPMX26_00196 in Acinetobacter radioresistens SK82

Annotation: Secretin XcpQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 751 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 34 to 653 (620 residues), 537.7 bits, see alignment E=1.9e-165 PF21305: type_II_gspD_N0" amino acids 34 to 102 (69 residues), 88.8 bits, see alignment E=2.6e-29 PF03958: Secretin_N" amino acids 129 to 185 (57 residues), 41.9 bits, see alignment 1.4e-14 amino acids 193 to 261 (69 residues), 49.1 bits, see alignment E=8.2e-17 amino acids 268 to 389 (122 residues), 58.4 bits, see alignment E=1e-19 PF00263: Secretin" amino acids 480 to 643 (164 residues), 170 bits, see alignment E=5.4e-54

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 80% identity to abm:ABSDF3255)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (751 amino acids)

>MPMX26_00196 Secretin XcpQ (Acinetobacter radioresistens SK82)
MALLQHHRPLWALVAAAPVIAAISTAAYAQTWKINLRDADLTAFINEVADITGKNFAVDP
RVRGNVTVISNKPLNKNEVYDLFLGVLNVNGVVAIPSGNTIKLVPDSNVKSSGVPYDARR
NARGDQVVTRVIWLENTNPNDLIPALRPLMPQFAHLAAVAGTNALIVSDRASNIAQLETI
VRNLDGTGQNDIEAITLQSSQAEEVIGLLESMSSTGAAKDFSGARVRIMADNRTNRILIK
GDPATRKRIRHMIEMLDVPSADRLGGLKVFRLKYASAQNLSEILQGLVTGQAVNSNSNSN
NSGSSNSINNLINNTANNNQGSTGSGISTPGINLNANTNSGQNPISSFNANGVSIIADTN
QNALVVKADPQLMREIESAIQQLDIRRQQVLIEAAIIEVAGDDADQLGVQWALGDISSGI
GLVNFTNVGSSLASLAAGYLAGGSALANAASNLRGSSLLLGDYREGADGSRRLYGALIQA
LKDNTKSNLLSTPSIVTMDNEEAYIVVGQNVPFVTGSVTTNANGVNPYTTVERKDVGVTL
KVIPHIGENGTVRLEVEQEVSNVQPNKGQATDLVTSKRAIKTAVLAEHGQTVVLGGLISD
NSIYSRQAVPGLGAIPGIGRLFRSDSNSNEKRNLLVFIHPTIVGDASDVRRLTQRRYDQL
YSLQLAMDKDGNFAKLPENVEDVYQQRLPVPATSDKPNVYKQLSSGGVTPVVTTTPVAIE
LGIGQRSVALPQPEVERTKNTVTTTTLRPAS