Protein Info for MPMX26_00187 in Acinetobacter radioresistens SK82

Annotation: Transcriptional regulatory protein YpdB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF00072: Response_reg" amino acids 3 to 111 (109 residues), 95 bits, see alignment E=3.2e-31 PF04397: LytTR" amino acids 148 to 242 (95 residues), 73.4 bits, see alignment E=1.5e-24

Best Hits

KEGG orthology group: K08083, two-component system, LytT family, response regulator AlgR (inferred from 76% identity to aci:ACIAD0285)

Predicted SEED Role

"Autolysis response regulater LytR" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>MPMX26_00187 Transcriptional regulatory protein YpdB (Acinetobacter radioresistens SK82)
MDILICDDEPLAVERLSRLVTQLGHHVVATTSSGQHTIELVQQYQPDVVLLDIQMPEMDG
LQCAEQLNQLDLMPAIVFCTAYEDHALEAFKSSAEGYLLKPIEVSELQQVLDRLTRLNQA
QMSGLKQKDIDTAKLQRQQITAKSYRGVELVPVENIYYFLADQKYVTVRHKHGSILIDET
LKELEQEFSEKFIRIHRNALVSVDYLDGLEVVTSGQYQVRCRELDERLAVSRRHLPGLRE
RIQKL