Protein Info for MPMX26_00183 in Acinetobacter radioresistens SK82

Annotation: Phosphate-specific transport system accessory protein PhoU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 TIGR02135: phosphate transport system regulatory protein PhoU" amino acids 14 to 224 (211 residues), 213.5 bits, see alignment E=1.4e-67 PF01895: PhoU" amino acids 29 to 114 (86 residues), 70.6 bits, see alignment E=5.8e-24 amino acids 132 to 216 (85 residues), 68.1 bits, see alignment E=3.6e-23

Best Hits

Swiss-Prot: 59% identical to PHOU_PSEAE: Phosphate-specific transport system accessory protein PhoU homolog (phoU) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02039, phosphate transport system protein (inferred from 91% identity to aci:ACIAD0279)

Predicted SEED Role

"Phosphate transport system regulatory protein PhoU" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>MPMX26_00183 Phosphate-specific transport system accessory protein PhoU (Acinetobacter radioresistens SK82)
MSLNNPVLSHHISSQFNEELQGVTTKFMTMGGLVEQQVANAIRALLDTDTNMAIDVQFQD
NVVNRYEREIDEGLTLILARRHPAAIDLRMVIAMSKANTDLERIGDEAAKIARIAQNLCE
EGGSPRGYMETRHIGNQVRVMIHDALDAFARVDAEQALKVLLADADIDREYQSATRTLMT
YMIEDPRHISRVLNVMWVLRSLERIGDHARNISEQVIYIAKGLDVRHTSLDEIEEHVQRR