Protein Info for MPMX26_00182 in Acinetobacter radioresistens SK82

Annotation: Outer membrane protein TolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 20 to 446 (427 residues), 255.9 bits, see alignment E=3.7e-80 PF02321: OEP" amino acids 24 to 223 (200 residues), 81.4 bits, see alignment E=3.8e-27 amino acids 246 to 432 (187 residues), 114.6 bits, see alignment E=2.5e-37

Best Hits

KEGG orthology group: K12340, outer membrane channel protein TolC (inferred from 68% identity to aby:ABAYE3514)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>MPMX26_00182 Outer membrane protein TolC (Acinetobacter radioresistens SK82)
MKKKIFLSLFFLTTSSQLYALDLVEAYQRAKQSDPSWQANLYQYQADQLNLGIARTNFLP
TVSVSGNITRKHQGSNQSNSVTIPGFENFGDALMSSTSTTKQISITARQPLFRKDAWEGY
KQVQTSVLLSEVQLRQRQQDHILNVAESYFNVLRQQTLTSSHLQEEKALLEQLEMMNAKL
REGLVARSDVSEANAQYQNARANRISSNVQLLLAQEQLAQLIGPYQESLAVLQENFSYQQ
PYPANLQEWTTLAQNQNLSVQQARLQQKYNDDQRRIERAALYPQLEAVATYGYTKQSPET
LISGDGQFDQIGVEMNWNLFNGGRTQQNIRKATVDIRRAEAELEAAVRKSTTDAKQAYLQ
VQTDQNKLEARKAAMQSSELVSRASRAQYNEGLKTIVDVLLAQRNAFSARQDYVNAQYDH
LINILRLKAAAGQLNEQDLQEMNSWLVEKF