Protein Info for MPMX26_00177 in Acinetobacter radioresistens SK82

Annotation: RNA polymerase-binding transcription factor DksA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 TIGR02420: RNA polymerase-binding protein DksA" amino acids 58 to 166 (109 residues), 169.2 bits, see alignment E=1.6e-54 PF21157: DksA_N" amino acids 62 to 132 (71 residues), 111.1 bits, see alignment E=2.5e-36 PF01258: zf-dskA_traR" amino acids 136 to 168 (33 residues), 45.3 bits, see alignment 6.9e-16

Best Hits

Swiss-Prot: 56% identical to DKSA_BUCAP: RNA polymerase-binding transcription factor DksA (dksA) from Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

KEGG orthology group: K06204, DnaK suppressor protein (inferred from 89% identity to acd:AOLE_18160)

Predicted SEED Role

"C4-type zinc finger protein, DksA/TraR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (177 amino acids)

>MPMX26_00177 RNA polymerase-binding transcription factor DksA (Acinetobacter radioresistens SK82)
MANDNHNQVLDEHTEAADSEKTAAKRTRKPKAKTSEAGTTASLFGIAPYQPKKNEEYMSE
GQLEHFRQILEAWKAELMSEVDRTLNTMQDENTALPDVNDRATQEEEFAIELRTRDRERK
LIRKIEQSLQTIKDEDYGFCETCGIEIGLRRLEARPTATLCIDCKTLAEIKEKQNNG