Protein Info for MPMX26_00176 in Acinetobacter radioresistens SK82

Annotation: Glutamyl-Q tRNA(Asp) synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 TIGR03838: glutamyl-queuosine tRNA(Asp) synthetase" amino acids 1 to 251 (251 residues), 338.7 bits, see alignment E=1.3e-105 PF00749: tRNA-synt_1c" amino acids 3 to 232 (230 residues), 151 bits, see alignment E=1.9e-48

Best Hits

Swiss-Prot: 75% identical to GLUQ_ACIAD: Glutamyl-Q tRNA(Asp) synthetase (gluQ) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K01894, glutamyl-Q tRNA(Asp) synthetase [EC: 6.1.1.-] (inferred from 77% identity to acd:AOLE_18165)

Predicted SEED Role

"glutamyl-Q-tRNA synthetase" in subsystem Queuosine-Archaeosine Biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.-

Use Curated BLAST to search for 6.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>MPMX26_00176 Glutamyl-Q tRNA(Asp) synthetase (Acinetobacter radioresistens SK82)
MGRFAPSPTGPLHFGSLITAVASYCDAKARQGKWLVRIEDTDIPRISLGSEQHILCAVEA
FGFEVDSHIIFQKDRLDIYESVLTQLRKQGLVYACQCTRKILGSNHIYTGTCRHLNLPFE
HQAIRIKVSDEELCFTDRLQGKHCSNLAYDLGDFVLKRRDGIINYQLAVVVDDYLQGVTH
VVRGADLLDNTVRQMWLGSVLGYPVLHYMHLPLAMNSQGQKLSKQNLALALDLSQPSVLL
QKALNALNQPAVDLDTPSLMLKQAISQWSVEAIPHSLMLNGHYL