Protein Info for MPMX26_00159 in Acinetobacter radioresistens SK82

Annotation: Lipopolysaccharide export system permease protein LptG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 302 to 321 (20 residues), see Phobius details amino acids 334 to 353 (20 residues), see Phobius details TIGR04408: LPS export ABC transporter permease LptG" amino acids 7 to 354 (348 residues), 362.2 bits, see alignment E=1e-112 PF03739: LptF_LptG" amino acids 10 to 354 (345 residues), 269 bits, see alignment E=3.1e-84

Best Hits

KEGG orthology group: K11720, lipopolysaccharide export system permease protein (inferred from 82% identity to aby:ABAYE3538)

Predicted SEED Role

"FIG000906: Predicted Permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>MPMX26_00159 Lipopolysaccharide export system permease protein LptG (Acinetobacter radioresistens SK82)
MLARRIVAKHVTKTTALAMLGATVVLSILQVLFTYLGELGNLKEGYNAWQALLYVLWSAP
RYIYEILPISALIGAVLGLGTLASNSELIIMRAAGISLWRIVGWVMRSALLLVILSFALS
EWVIPVTNERAESVKSHRSVAQLGEVKGYWSREGQRFIYIDYANSQGNLRNVQVVDFDQD
YRLQALLNADSGQFEQDGQWRLQNSVQVDILEAGNAVQHIAEQQPLALALKPKYVHMVTL
DPEDLSPSQLISFMRYMEEYSQVPKTYQLAFWQKLASPFALITLVLIACSFIFGPLRQQS
MGFRLVIALFIGLGFYYLQDFLGYASLVYSPSPVWFVFFPILLMFIGGSYLLYRAR