Protein Info for MPMX26_00158 in Acinetobacter radioresistens SK82

Annotation: Lipopolysaccharide export system permease protein LptF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 269 to 290 (22 residues), see Phobius details amino acids 302 to 319 (18 residues), see Phobius details amino acids 331 to 348 (18 residues), see Phobius details TIGR04407: LPS export ABC transporter permease LptF" amino acids 2 to 343 (342 residues), 332.5 bits, see alignment E=1.2e-103 PF03739: LptF_LptG" amino acids 5 to 342 (338 residues), 198.2 bits, see alignment E=1e-62

Best Hits

KEGG orthology group: K07091, lipopolysaccharide export system permease protein (inferred from 82% identity to aby:ABAYE3539)

Predicted SEED Role

"FIG000988: Predicted permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>MPMX26_00158 Lipopolysaccharide export system permease protein LptF (Acinetobacter radioresistens SK82)
MIIRRYLVKQVVSTSLVVIALLTLIMMGGRLIKYFGVAAQGRLDASILLSIIGYRLPEFL
TLILPLGFFIGLMLVFGRLYVDHEMAVLNGSGISRNRLARLLIPLTLVYMLVQSILMLWM
SPWGIRQFEQLTTSQAVRTGFDLVRPKEFISSGPYTIYAGSLSEDHKNLKEIFFYQRAEK
PGKPDVMILAKEATRVEMMDDSANVVDLVQGRRYEIYPGQPRYSQAEFESYRLRLENDKT
ANFESDDVAALTTSKLWEQRADPVVESELGWRIFVPFAIMVALILAMALSEVSPRQGRYM
KLFPALLIFASLIVALMAIKTRASKDEIGIWAYPAVLLVYAVAGALFSRKQKLAPKLKKQ
IKRVRS