Protein Info for MPMX26_00136 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 49 to 71 (23 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 125 to 150 (26 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 214 to 230 (17 residues), see Phobius details PF03741: TerC" amino acids 17 to 205 (189 residues), 165.7 bits, see alignment E=1.3e-52 PF00571: CBS" amino acids 381 to 430 (50 residues), 21.1 bits, see alignment 4.8e-08 PF03471: CorC_HlyC" amino acids 445 to 520 (76 residues), 63.5 bits, see alignment E=2.2e-21

Best Hits

KEGG orthology group: None (inferred from 86% identity to abc:ACICU_00210)

Predicted SEED Role

"Putative capsular polysaccharide transport protein YegH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (533 amino acids)

>MPMX26_00136 hypothetical protein (Acinetobacter radioresistens SK82)
MIFEWMSDPSAWVGLVTLVVLEIVLGIDNLVFIAILAEKLPPHQRNTARILGLILALGMR
LILLASIAWVVTLTDPLFHIFDHPFSGRDLILLFGGVFLLFKGTMELHERIESNHAHKEE
NPVHAAFWMVIVQIVVLDAVFSLDSVITAVGMVKELSVMMIAVIIAVGIMLWASKPLMEF
VNRHPTVVILCLGFLMMIGFSLVVEGFGFHIPKGYLYAAIGFSVLVEMVNQTMRRNQEKL
VTTTDLRYRTASAVMRMLGGKNTSNSNESPSNEPEDVLATRAFADEVFDEKNGVYHSVMV
QGVLGLAERPVKSVMTPRPELEWIDLDEDAEVIKERLLSMTHSRLIVAHGELDNIAGIAL
THKVLNEYIETGTLNFEKHLREPVIVHENAQVLMVMEQLRQAPLQMAIVLNEYGSIEGIA
TPIDVLEAIAGEFPDEDELEAAAESLEDGSLMLEGSTDIRHVSLLLGRNLVDESEQYSTL
SGYMLYHLGHLPVNGEKLLADGHIFEVVTMDGHKIEKIHIMTSDQPASDEEYR