Protein Info for MPMX26_00104 in Acinetobacter radioresistens SK82

Annotation: ATP synthase subunit beta 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 TIGR01039: ATP synthase F1, beta subunit" amino acids 3 to 464 (462 residues), 837.7 bits, see alignment E=1.2e-256 PF02874: ATP-synt_ab_N" amino acids 6 to 71 (66 residues), 64.7 bits, see alignment E=1.3e-21 PF00006: ATP-synt_ab" amino acids 128 to 346 (219 residues), 239 bits, see alignment E=6.6e-75 PF22919: ATP-synt_VA_C" amino acids 353 to 431 (79 residues), 52.6 bits, see alignment E=5.8e-18

Best Hits

Swiss-Prot: 98% identical to ATPB_ACIBC: ATP synthase subunit beta (atpD) from Acinetobacter baumannii (strain ACICU)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 98% identity to aci:ACIAD0187)

MetaCyc: 79% identical to ATP synthase F1 complex subunit beta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>MPMX26_00104 ATP synthase subunit beta 1 (Acinetobacter radioresistens SK82)
MSSGRIIQIIGAVIDVEFERNSVPKIYDALQVDGTETTLEVQQQLGDGVVRTIAMGSTEG
LKRGLPVTNSGAPISVPVGTACLGRIMDVLGRPIDEAGPVATEERLPIHRQAPSYAEQAA
STDLLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELINNIAKAHSGLSVFAGVGE
RTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTGLTMAEYFRDEKDENGKGR
DVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKNGSITSIQA
VYVPADDLTDPSPATTFAHLDATVVLSRDIASSGIYPAIDPLDSTSRQLDPLVVGQEHYE
IARSVQNVLQRYKELKDIIAILGMDELAEEDKLVVYRARKIQRFFSQPFHVAEVFTGAPG
KLVPLKETIRGFKGLLAGEYDHIPEQAFYMVGGIDEVIAKAEKL