Protein Info for MPMX26_00078 in Acinetobacter radioresistens SK82

Annotation: Arginine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 PF03485: Arg_tRNA_synt_N" amino acids 5 to 91 (87 residues), 79.1 bits, see alignment E=4.6e-26 TIGR00456: arginine--tRNA ligase" amino acids 6 to 596 (591 residues), 435 bits, see alignment E=1.9e-134 PF00750: tRNA-synt_1d" amino acids 101 to 177 (77 residues), 39.3 bits, see alignment E=6.3e-14 amino acids 292 to 444 (153 residues), 43.9 bits, see alignment E=2.5e-15 PF05746: DALR_1" amino acids 475 to 596 (122 residues), 111.7 bits, see alignment E=3.3e-36

Best Hits

Swiss-Prot: 91% identical to SYR_ACIB5: Arginine--tRNA ligase (argS) from Acinetobacter baumannii (strain AB0057)

KEGG orthology group: K01887, arginyl-tRNA synthetase [EC: 6.1.1.19] (inferred from 90% identity to abm:ABSDF0155)

Predicted SEED Role

"Arginyl-tRNA synthetase (EC 6.1.1.19)" (EC 6.1.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (596 amino acids)

>MPMX26_00078 Arginine--tRNA ligase (Acinetobacter radioresistens SK82)
MNTAIQAALDHAVQSLQNQGVFPTEWTNSSSLTRTKDRSHGDFASNIAMIGAKAAGMKPR
DLAEKILANLPEVADISKAEIAGPGFINFFLNADQRFAVLDQIQAQKDQYGRTQVNAAKK
IQVEFVSANPTSSLHVGHGRGAAYGMTVATLLEATGAKVDREYYVNDAGRQMDILATSTY
LRYLELLGQDLVFPKNAYQGDYVKEIAQGIIDLKGEAYVHPVADVYKDVPEDVQYAAEPD
SEGNKVVLSGDKEKHIDGLIFNAQHLLGEGYRVFHQAALKAILDDIKDDLGEFGVTFNEW
FSEASLTEKIDEALQTLDQRGFLYEKDGNIWFKSTEFGDEKDRVVKRRNGQTTYFASDIA
YHLNKLQRGYTDLIDIWGSDHHGYISRVKAAIEAMGYDSKKLTVLLVQFVSLWRSGEMVQ
MSSRSGQFVTLRDLRKEVGNDAARFYYVMRKSEQHIDFDLDLAVSQSKDNAVYYIQYAHA
RICRMLEKAASNGIVLNVSTARSHAPRLELDAETELLAKLAAYPDIVIRAANVYEPHQVG
NYLKELAALFHGWYNEHKVLGNDAELTQARLLLSVNVQQVLRNGLELLGVSAPTTM