Protein Info for MPMX26_00050 in Acinetobacter radioresistens SK82

Annotation: UDP-N-acetyl-D-glucosamine 6-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 8 to 408 (401 residues), 401.2 bits, E=2.3e-124
• PF03721: UDPG_MGDP_dh_N
  • amino acids 8 to 181 (174 residues), 113.7 bits, E=1.2e-36
• PF00984: UDPG_MGDP_dh
  • amino acids 203 to 291 (89 residues), 89.5 bits, E=1.9e-29
• PF03720: UDPG_MGDP_dh_C
  • amino acids 318 to 418 (101 residues), 83.5 bits, E=1.9e-27

Best Hits

Swiss-Prot: 68% identical to VIPA_SALTI: Vi polysaccharide biosynthesis protein VipA/TviB (vipA) from Salmonella typhi

KEGG orthology group: K02474, UDP-N-acetyl-D-galactosamine dehydrogenase [EC: 1.1.1.-] (inferred from 86% identity to abn:AB57_0094)

MetaCyc: 76% identical to UDP-N-acetylgalactosamine 6-dehydrogenase (Pseudomonas aeruginosa)
UDP-N-acetylglucosamine 6-dehydrogenase. [EC: 1.1.1.136]; 1.1.1.136 [EC: 1.1.1.136]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• UDP-N-acetyl-α-D-galactosaminuronate biosynthesis (2/2 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-xylose biosynthesis (1/2 steps found)
• colanic acid building blocks biosynthesis (7/11 steps found)
• UDP-2,3-diacetamido-2,3-dideoxy-α-D-mannuronate biosynthesis (1/5 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (8/24 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Starch and sucrose metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.22

Use Curated BLAST to search for 1.1.1.- or 1.1.1.136 or 1.1.1.22

Protein Sequence (425 amino acids)

>MPMX26_00050 UDP-N-acetyl-D-glucosamine 6-dehydrogenase (Acinetobacter radioresistens SK82)
MLQLPELKIAIIGLGYVGLPLAVEFGKKVPVVGFDIYQKRIDELRNGQDHTLEVSPEELK
QANQLSYSANLEDLQGCNFFIVTVPTPIDEFKQPDLTPLVKASTSIGQVLKKGDVVVYES
TVYPGATEETCIPVLEQVSGLQFNQDFFAGYSPERINPGDKLHRVTNILKITSGSTPEVA
EFVDQVYNLVIEAGTHKATSIKVAEAAKVIENTQRDVNIALINELAVIFNKMGIDTEAVL
QAAGTKWNFLPFRPGLVGGHCIGVDPYYLTHKAQSIGYHPEIILAGRRLNDGMGAYVVTQ
LVKAMIKKKIQVEGAKVLVLGLSFKENCPDIRNTKIIDIVNELTEYNIAADVYDPWVDAN
EAQHEYGITPVKNLEQGQYDAVILAVAHDQFKAMGAEALRALGKSAHILYDLKYVLDQSE
SDLRL