Protein Info for MPMX26_00044 in Acinetobacter radioresistens SK82

Annotation: putative lipid II flippase MurJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 50 to 68 (19 residues), see Phobius details amino acids 88 to 114 (27 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 186 to 208 (23 residues), see Phobius details amino acids 230 to 254 (25 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 313 to 337 (25 residues), see Phobius details amino acids 349 to 374 (26 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details amino acids 415 to 436 (22 residues), see Phobius details amino acids 451 to 473 (23 residues), see Phobius details amino acids 483 to 505 (23 residues), see Phobius details TIGR01695: murein biosynthesis integral membrane protein MurJ" amino acids 3 to 505 (503 residues), 454.8 bits, see alignment E=2e-140 PF03023: MurJ" amino acids 30 to 476 (447 residues), 446.1 bits, see alignment E=1.3e-137

Best Hits

Swiss-Prot: 36% identical to MURJ_BUCAP: Probable lipid II flippase MurJ (murJ) from Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

KEGG orthology group: K03980, virulence factor (inferred from 90% identity to aby:ABAYE3821)

Predicted SEED Role

"Proposed peptidoglycan lipid II flippase MurJ" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>MPMX26_00044 putative lipid II flippase MurJ (Acinetobacter radioresistens SK82)
MALWRSTFIVSAMTMLSRVLGLVRDVVLLNVFGAGKDFDTFVVAFRIPNFFRRLFAEGAF
SQAFIPVLTEYKTSRTHAEVQILISRVFGCLLTVMTLLTFIAMVAAPAILYIYAPGFHDD
PAKFDLAVDMFRLTIPYLMFMSLTAFASSILNSYGSFSTPAFSPVLLNVAMIAGAWWLTP
YMAEPIMALGWAVVVAGILQLAIQIPELWRKKLLIPPKVDFKHEGVERILKLMLPALFGV
SVTQINLLLNTIWASFMQDGSVSWLYSAERMTELPLGLIGVAIGTVILPSLSARHAEQDQ
TKFRGMLDWAARVIMLVGIPASIALFMLSTPIIQALFERGEFTWEDTQMTALALQCMSAG
VIAFMLIKVFAPGFYAQQDTKTPVRVGLIAVATNAILNIVFIGFFKLINWHAEHMALALA
SSGSALANAGLLYYYLHKRNIFRFGSHWKKLFIQFVVANTIMATALWFGLQWYNGELSQW
LRVAEVAGLCIVGVLAYAIGLLVSGFHPRQLKH