Protein Info for MPMX26_00032 in Acinetobacter radioresistens SK82

Annotation: putative oxidoreductase YciK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00106: adh_short" amino acids 16 to 213 (198 residues), 150 bits, see alignment E=8.7e-48 PF08659: KR" amino acids 18 to 177 (160 residues), 36.5 bits, see alignment E=7.2e-13 PF13561: adh_short_C2" amino acids 22 to 244 (223 residues), 125.5 bits, see alignment E=4e-40

Best Hits

Swiss-Prot: 51% identical to YCIK_ECOLI: Uncharacterized oxidoreductase YciK (yciK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to abm:ABSDF0043)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>MPMX26_00032 putative oxidoreductase YciK (Acinetobacter radioresistens SK82)
MKYSQYQPRPDLLKNQVILITGAGDGIGRAAALSYALHGATVVLHGRTLNKLEVIYDEIE
ALGAPQPAILPLQLSSASAQDYEHLVNILDKQFGRLDGILHNAGILGERIELAHYPAEVW
DDVMAVNLRAPFVLTQALLPLLQKSEHASVVFASSGVGREVRERWGAYSVSKIAIEAVSK
LFAVENQHPNIRFNCINPGATRTAMRAKAFPDEDPKVLATPETIMPAYLYLMGEDSRHMN
GQSIDAQD