Protein Info for MPMX26_00029 in Acinetobacter radioresistens SK82

Annotation: Amino-acid acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 TIGR01890: amino-acid N-acetyltransferase" amino acids 15 to 448 (434 residues), 586.1 bits, see alignment E=2.3e-180 PF00696: AA_kinase" amino acids 31 to 270 (240 residues), 94.4 bits, see alignment E=1.4e-30 PF00583: Acetyltransf_1" amino acids 329 to 419 (91 residues), 42.8 bits, see alignment E=8.9e-15 PF13508: Acetyltransf_7" amino acids 337 to 420 (84 residues), 40.2 bits, see alignment E=5.7e-14

Best Hits

Swiss-Prot: 53% identical to ARGA_SERP5: Amino-acid acetyltransferase (argA) from Serratia proteamaculans (strain 568)

KEGG orthology group: K14682, amino-acid N-acetyltransferase [EC: 2.3.1.1] (inferred from 79% identity to acd:AOLE_19250)

MetaCyc: 51% identical to N-acetylglutamate synthase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>MPMX26_00029 Amino-acid acetyltransferase (Acinetobacter radioresistens SK82)
MNSLETANTTEQLNVRWFRHSAPYINAHRNKTFVIMFGGEAVCHDNFQHIIHDIALLNSL
GIRLVLVHGARPQINQNLEQFQLSAPFHKNRRITTRESLGCVMSAVGSIRLQIEALLSTG
LANSPMYGAAIHVVSGNFVTAKPYGIHDGIDFQLTGEVRSIDSTSIHQHLEHNSIVLLGP
TGYSTTGEVFNLLAEEVATKTAVALKADKLIFLGQQQGLLNSKQQLLRELTPQQLDPYIE
QHEQADPTQALYLRAARDASLEGVNRVHLISYTYDGALIEELFTRDGIGTMITDAHYEEV
RTARIQDVGGLIKLLRPLEQEGILVYRSRERLETEINQFAVIERDGTILACAALYPIPTL
KNEIPSAEIACVAVHPAYRKSNRGSQILNFLEKKAQENGIKQLFVLTTRTAHWFLEHGFM
PASVDDLPNTRQALYNYQRNSLVFKKQL