Protein Info for MPMX19_06979 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 103 to 126 (24 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details PF04290: DctQ" amino acids 39 to 169 (131 residues), 65.8 bits, see alignment E=1.8e-22

Best Hits

KEGG orthology group: None (inferred from 62% identity to azc:AZC_2523)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctQ subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>MPMX19_06979 hypothetical protein (Azospirillum sp. SherDot2)
MTSSPPSPLITALVGVCRLVDAVTVRLGKAISWLILLAILVSAVNAVIRKLFDVSSNSWL
ELQWVLFAAVFLLCSPWTLREDEHIRIDIVNAMLTKRARDGIDLFGHIAFLLPFSFVMMI
TSWPFALASYAIEEQSMNAGGLPQWPAKLLIPLGFTVLFVQGLSELVKRAAIMAGHLEDG
TQRAGGHQAAAEAEAERLLAAERERATPPDTIPSR