Protein Info for MPMX19_06904 in Azospirillum sp. SherDot2

Annotation: putative tautomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00013: 4-oxalocrotonate tautomerase family enzyme
  • amino acids 1 to 57 (57 residues), 65.2 bits, E=2.3e-22
• PF01361: Tautomerase
  • amino acids 2 to 58 (57 residues), 66.7 bits, E=1.3e-22
• PF14552: Tautomerase_2
  • amino acids 3 to 52 (50 residues), 38.1 bits, E=1.4e-13

Best Hits

Swiss-Prot: 49% identical to Y4393_RALSO: Probable tautomerase RSp0893 (RSp0893) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01821, 4-oxalocrotonate tautomerase [EC: 5.3.2.-] (inferred from 48% identity to msl:Msil_1481)

MetaCyc: 48% identical to 4-oxalocrotonate tautomerase subunit (Pseudomonas putida mt-2)
RXN-8529 [EC: 5.3.2.6]

Predicted SEED Role

No annotation

MetaCyc Pathways

• 3-chlorocatechol degradation III (meta pathway) (2/4 steps found)
• 4-amino-3-hydroxybenzoate degradation (3/6 steps found)
• orthanilate degradation (2/5 steps found)
• protocatechuate degradation III (para-cleavage pathway) (2/5 steps found)
• catechol degradation to 2-hydroxypentadienoate II (1/4 steps found)
• catechol degradation II (meta-cleavage pathway) (3/7 steps found)
• 2,3-dihydroxybenzoate degradation (1/5 steps found)
• meta cleavage pathway of aromatic compounds (4/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (4/13 steps found)
• 4-chloronitrobenzene degradation (1/9 steps found)
• 2,2'-dihydroxybiphenyl degradation (1/10 steps found)
• superpathway of aerobic toluene degradation (11/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (10/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Fluorene degradation

Isozymes

Compare fitness of predicted isozymes for: 5.3.2.-

Use Curated BLAST to search for 5.3.2.- or 5.3.2.6

Protein Sequence (63 amino acids)

>MPMX19_06904 putative tautomerase (Azospirillum sp. SherDot2)
MPIVNITLIKGRSQEKKAAMYREVTEAIHRTLGAPRESVRIMVNEIEPEHFAVAGEAKTG
PSS