Protein Info for MPMX19_06856 in Azospirillum sp. SherDot2

Annotation: Riboflavin transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 101 to 118 (18 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 210 to 229 (20 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details PF00892: EamA" amino acids 32 to 164 (133 residues), 39 bits, see alignment E=4.7e-14 amino acids 179 to 308 (130 residues), 29.3 bits, see alignment E=4.9e-11

Best Hits

KEGG orthology group: None (inferred from 86% identity to azl:AZL_c03150)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>MPMX19_06856 Riboflavin transporter (Azospirillum sp. SherDot2)
MPGQTPEPSAGSQADSVPDPSPVPSSSASRGGIMLRLVSAGLFVVMSLFVRLASVEAPIG
QIVFFRSAFALPPIIAYLMWRRQFPSALWTRQPVGHLKRNLYGGLAMVLSFVSLAYLPLA
LATALGFLAPLLAVPAAMLFLRERPGAVAIGAALVGFAGVVLMLLPAFEGPTPDRGTLIG
VAAGLTMAFATAAGRVQIKTLTATEAPGTIAFYFALLCALGGLASWPFGWIAPTGFSLAC
LIGAGVSGGLAHITMTEAMARASVSTQAPFDYTAMLWALILDAAIFGLLPSPVSLAGAFV
IAASALVVPLSGRFTARSEALRPAR