Protein Info for MPMX19_06828 in Azospirillum sp. SherDot2

Annotation: Delta(1)-pyrroline-2-carboxylate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR02992: ectoine utilization protein EutC" amino acids 4 to 333 (330 residues), 548.6 bits, see alignment E=2.2e-169 PF02423: OCD_Mu_crystall" amino acids 21 to 325 (305 residues), 223.9 bits, see alignment E=1.3e-70

Best Hits

Swiss-Prot: 74% identical to Y0419_RHIME: Putative dehydrogenase RB0419 (eutC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01750, ornithine cyclodeaminase [EC: 4.3.1.12] (inferred from 76% identity to rhi:NGR_b23260)

Predicted SEED Role

"Ornithine cyclodeaminase (EC 4.3.1.12)" in subsystem Arginine and Ornithine Degradation (EC 4.3.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.12

Use Curated BLAST to search for 4.3.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>MPMX19_06828 Delta(1)-pyrroline-2-carboxylate reductase (Azospirillum sp. SherDot2)
MPRMTILTEAELRRIVPLDRDAVACVEDAFLALATRPVAMPPILRLDIPEFAGSSGGEVD
VKTAYVPGLDGFAIKISPGFFGNPALGLPSVNGLMVLLSSRTGLVEALLLDNGYLTDVRT
AAAGAVAASHLSRPDSAVAAIFGAGVQAALQLEALTLVRPIREARLWARQPERAAAAAAR
LSERLGFPVHAATDGRSAVAGADIVVTTTPADRPILMADWLEPGQHVTAMGSDAEHKNEL
DPAILSRADLYVADRLTQTRRLGELHHAIAAGTVAADRDFPELGAVIAGQAAGRASTDAI
TVCDLTGTGVQDTAIATLARGRALAAGAGTVFDA