Protein Info for MPMX19_06809 in Azospirillum sp. SherDot2

Annotation: Glutathione-regulated potassium-efflux system ancillary protein KefF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03358: FMN_red
  • amino acids 1 to 155 (155 residues), 37.7 bits, E=1.5e-13
• PF02525: Flavodoxin_2
  • amino acids 1 to 213 (213 residues), 181 bits, E=2.3e-57

Best Hits

KEGG orthology group: K00355, NAD(P)H dehydrogenase (quinone) [EC: 1.6.5.2] (inferred from 77% identity to mlo:mll7814)

MetaCyc: 75% identical to roxarsone nitroreductase (Sinorhizobium meliloti)
1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]; 1.7.1.M3 [EC: 1.7.1.M3]

Predicted SEED Role

"NAD(P)H oxidoreductase YRKL (EC 1.6.99.-) @ Putative NADPH-quinone reductase (modulator of drug activity B) @ Flavodoxin 2" (EC 1.6.99.-)

MetaCyc Pathways

• superpathway of photosynthetic hydrogen production (3/6 steps found)
• vitamin K-epoxide cycle (1/4 steps found)
• roxarsone (and nitarsone) degradation IV (2/6 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.2

Use Curated BLAST to search for 1.6.5.2 or 1.6.99.- or 1.7.1.M3

Protein Sequence (267 amino acids)

>MPMX19_06809 Glutathione-regulated potassium-efflux system ancillary protein KefF (Azospirillum sp. SherDot2)
MKILLVFAHPEPRSLSASLRDVAIQDLEAQGHEVQLSNLYDMGWKSEIDRDDFPTLPAGD
RLKVPGSSRGAFDAAALTADVRTEIGKLRWADTLILQFPLWWFSMPAILKGWVDRVYANG
FAYGVGEHSDRRWGDRYGEGALAGKRAMLIVTAGGWEDHYSPRGINGPMDDLLFPINHGI
LHYPGYEVLPPFVVYRADRLDEAGFEQVAERLRGRMRTLATTTPLPFRRQNGGDYLIPAM
QLRPGLEAPGVAGFTLHLTHGDPGKID