Protein Info for MPMX19_06729 in Azospirillum sp. SherDot2

Annotation: UDP-glucose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05368: NmrA
  • amino acids 6 to 124 (119 residues), 38.2 bits, E=5.1e-13
• PF04321: RmlD_sub_bind
  • amino acids 8 to 164 (157 residues), 42.6 bits, E=1.7e-14
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 9 to 329 (321 residues), 437.3 bits, E=1.4e-135
• PF02719: Polysacc_synt_2
  • amino acids 9 to 180 (172 residues), 42.5 bits, E=1.9e-14
• PF01370: Epimerase
  • amino acids 9 to 258 (250 residues), 213.8 bits, E=1e-66
• PF16363: GDP_Man_Dehyd
  • amino acids 10 to 312 (303 residues), 159.4 bits, E=6.7e-50
• PF01073: 3Beta_HSD
  • amino acids 10 to 250 (241 residues), 53.9 bits, E=5.9e-18
• PF13460: NAD_binding_10
  • amino acids 13 to 175 (163 residues), 33.8 bits, E=1.3e-11
• PF07993: NAD_binding_4
  • amino acids 72 to 202 (131 residues), 20.4 bits, E=1e-07

Best Hits

Swiss-Prot: 64% identical to EXOB_AZOBR: UDP-glucose 4-epimerase (exoB) from Azospirillum brasilense

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 94% identity to azl:AZL_f01830)

MetaCyc: 52% identical to UDP-xylose 4-epimerase subunit (Sinorhizobium meliloti 1021)
UDP-arabinose 4-epimerase. [EC: 5.1.3.5]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-β-L-arabinose biosynthesis I (from UDP-α-D-xylose) (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• stachyose degradation (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• UDP-sugars interconversion (4/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.5

Protein Sequence (331 amino acids)

>MPMX19_06729 UDP-glucose 4-epimerase (Azospirillum sp. SherDot2)
MTTSDNATVLVTGGAGYIGSHVVLALRDQGRAVVVLDDLSTGRRSALPDGVPLVEGDVGD
KPLLADTFARHGIGTVMHFAGSIVVPESVERPLAYYRNNTVKSHALVEACVEAGIGRFIF
SSTAAVYGMPERLPIDEQTPTKPINPYGSSKLMTEWMLRDTAAAHDLRYVALRYFNVAGA
DPQGRSGQVSKVATHLIKIAAQTVTGQRAELQIYGDDYDTADGTCVRDYIHVSDLADAHV
AALRHLEAGGASEVMNCGYGRGYSVREVLAMVERVTGKPLPMRIGPRRAGDPPALVAGVE
RIGRTLDWTPRHADLETIVASALSWEERLVR