Protein Info for MPMX19_06721 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 32 to 49 (18 residues), see Phobius details amino acids 70 to 96 (27 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 151 to 177 (27 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details PF01061: ABC2_membrane" amino acids 55 to 260 (206 residues), 84.4 bits, see alignment E=4.3e-28

Best Hits

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 56% identity to net:Neut_0146)

Predicted SEED Role

"O-antigen export system permease protein RfbD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>MPMX19_06721 hypothetical protein (Azospirillum sp. SherDot2)
MLSLEPRRSGGYGRPAADGEYSKLFNSQSGNPTVAGFGAGPFALFQTAWHHRSLILRLAR
REIDARYRGSVLGIVWAVLNPILMLAVYTFVFSVVFQARWGATGGSNTEFALLLFSGLIL
FNVLGECLSRAPGLLLENVSYIKKVVFPLEILPLVSLAVALFNAGIGFVILVVFHLMVAG
LPPPTALLLPLVLVPLCLTTLGLSWFFAAAGVFLRDLRQVVGVAVTVLMFLSPIFYPMTA
IPERFRAILHLNPMTAILEQSKDLLFWGRVPSPLDWGLATLGAWAVAWLGYLWFMKTRRG
FADVV