Protein Info for MPMX19_06630 in Azospirillum sp. SherDot2

Annotation: Secretory immunoglobulin A-binding protein EsiB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF08238: Sel1" amino acids 46 to 81 (36 residues), 39 bits, see alignment 4.1e-14 amino acids 83 to 110 (28 residues), 12.1 bits, see alignment (E = 1.3e-05) amino acids 119 to 153 (35 residues), 35.7 bits, see alignment 4.7e-13 amino acids 154 to 189 (36 residues), 31.9 bits, see alignment 7.1e-12 amino acids 190 to 224 (35 residues), 36.9 bits, see alignment 1.8e-13 amino acids 227 to 261 (35 residues), 38.4 bits, see alignment 6.3e-14 amino acids 262 to 297 (36 residues), 33.2 bits, see alignment 2.7e-12 amino acids 299 to 333 (35 residues), 33.5 bits, see alignment 2.2e-12 amino acids 336 to 369 (34 residues), 22.2 bits, see alignment 8.1e-09

Best Hits

KEGG orthology group: K07126, (no description) (inferred from 60% identity to azl:AZL_f01570)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>MPMX19_06630 Secretory immunoglobulin A-binding protein EsiB (Azospirillum sp. SherDot2)
MFGKRKRTTSTVFKKPDFQRGLAAFEAEDYAGAVANWLPLAEHGDAEAQFRLGQLYTRGQ
GLVRDFGDAAHWFRKAAEQGHREAQFSLALCYANGEGAAQDSALPVRWYKTVSKASPPTA
EANLALLYPNGLGITPDIAQALHWYRLAAEAGHAEAQHHMGLLHAFGQGVPQDLGAAADW
YRRSAESGYAVAQHALASFYANGQGVERDIGQAIAWYGRAADQGFANAQLALAIIYEHGT
GVEADPARAAEFYRQAAEQGHPVAQVNLGLLYARGQGVPKDYRETLKWCRLSAEKGNVNA
QFNLGLIHSNGLAGQPDYAEAALWYRKAANQGNVGAQVNLGLMLIHGWGGRPELGEGVDW
LRKAAAQGHTGAMSNLGALYADQGSKAYNPVQAYVWTIMAAAATQPGSERDGLEAKAHEL
GNQLTSEDRQKAQVIMENWKKNPKLMVTG