Protein Info for MPMX19_06448 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 43 to 68 (26 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 143 to 163 (21 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details PF03988: DUF347" amino acids 24 to 75 (52 residues), 52.8 bits, see alignment E=1.8e-18 amino acids 79 to 130 (52 residues), 57.5 bits, see alignment E=6.1e-20 amino acids 144 to 192 (49 residues), 45.6 bits, see alignment 3.3e-16 amino acids 199 to 251 (53 residues), 58.3 bits, see alignment E=3.5e-20

Best Hits

KEGG orthology group: None (inferred from 78% identity to bma:BMA3080)

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>MPMX19_06448 hypothetical protein (Azospirillum sp. SherDot2)
MHATHDARASGTGMLNKVPEVTLIFWIIKIMSTTVGETGADYLAVHVGLGTGLTGGIMAM
LLGGALLLQLRARAYVPWIYWLTVVLVSVVGTQITDALTDGLNVSLYVSTTVFAVALAAI
FATWYAAERTLSIHTIVTSRREVFYWTAILFTFALGTAAGDLATEALQLGFRLGVLVFGG
LIALVTLAYYRSADPILTFWIAYVLTRPLGASLGDFLSQAQQYGGLGLGTIMTSAVFLVV
IVALVAMVSVTTAQHRNASVGDEA