Protein Info for MPMX19_06413 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 PF00353: HemolysinCabind" amino acids 47 to 81 (35 residues), 28.4 bits, see alignment 6.4e-11 amino acids 64 to 98 (35 residues), 35.8 bits, see alignment 3.1e-13 amino acids 74 to 108 (35 residues), 32.4 bits, see alignment 3.6e-12 amino acids 91 to 126 (36 residues), 30.7 bits, see alignment 1.2e-11 amino acids 135 to 151 (17 residues), 15 bits, see alignment (E = 1e-06) amino acids 298 to 332 (35 residues), 18.9 bits, see alignment 5.9e-08 amino acids 315 to 350 (36 residues), 26.4 bits, see alignment 2.7e-10 amino acids 333 to 368 (36 residues), 23.1 bits, see alignment 2.9e-09 amino acids 342 to 375 (34 residues), 16.5 bits, see alignment (E = 3.3e-07) amino acids 377 to 393 (17 residues), 9.5 bits, see alignment (E = 5.2e-05)

Best Hits

Predicted SEED Role

"Alkaline phosphatase (EC 3.1.3.1)" in subsystem Phosphate metabolism (EC 3.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.1

Use Curated BLAST to search for 3.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (494 amino acids)

>MPMX19_06413 hypothetical protein (Azospirillum sp. SherDot2)
MPDEWTPEGHGSTAANSELAAKYLQLSGLTFDFASGDQDVNYRIAIGEDGPTTIRGDEDR
DYLWGLAGSDRLLGGAGDDVLHADRGDDVLFGGMGSDALDGGRGDDSLYGGAGADNLIGG
DGNDLLDEGPGHSMVTGGMGNDTLIGGAGPDAFAMDRTSGDDVIRDFTAGPGMFDHLALR
DLRWDDLTIEGVDGGVLVRWEGGSVLLEGVQRSQLAQDDFMFADAPDLPPGARKPDDPGE
GRIVTTAFPEAGKGAWIGGEFDRAADKALKDGSVSFDFHGDTTYRLIAGRPTDDDRGGGE
TSDHIFGRNGDDRYIGYGGDDDLNGDAGNDRLDGGAGMDRLDGGVGNDTLFGGNEMDELI
GGSGKDYLDEGAGHGMLNGGMGDDYLVGGPGADAFMVMADSGNDVVADFEAGGAAQGAFD
HIAFQDIMPNQVSVAEREDGTLVNWSVDNSPGPDGSVLLLGVAAGDLRQSDFMFGEAPGF
VNGVSDAGSWYIFS