Protein Info for MPMX19_06400 in Azospirillum sp. SherDot2

Annotation: Protease HtpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 45 to 70 (26 residues), see Phobius details amino acids 163 to 186 (24 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details PF01435: Peptidase_M48" amino acids 80 to 282 (203 residues), 103.8 bits, see alignment E=5.4e-34

Best Hits

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 46% identity to dde:Dde_2161)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>MPMX19_06400 Protease HtpX (Azospirillum sp. SherDot2)
MVRFNERQHRRDKLRNAGQSILLVGSLALLAVAIGWLLGGWFGVLWAAILIGATVVFSPT
VSPHAVLGLYGTRRLNPHDLPEIHQVIQVLAQRAGLPSVPELHYFATPVPNAFTVGSSRS
SAIILTDGLLRAMTLRELAGILAHEVSHVRNHDLWIMGLADIISRVTGAMATIGVVLLLL
SLLQMAEQHSSVHWPLIALLWGAPTINTLIQLQLSRTREFDADLDAAALTGDPEGLASAL
AKLQRYDPGFWERILWPGRRNPHPSVLRTHPEPEERIERLLSLRQANAAHPTVEARTVGL
PTHWTQPTHRPRWRVSGLWH