Protein Info for MPMX19_06381 in Azospirillum sp. SherDot2

Annotation: putative manganese efflux pump MntP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 51 to 80 (30 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details PF02659: Mntp" amino acids 32 to 180 (149 residues), 161.4 bits, see alignment E=7.1e-52

Best Hits

Swiss-Prot: 66% identical to MNTP_RHOP5: Putative manganese efflux pump MntP (mntP) from Rhodopseudomonas palustris (strain BisA53)

KEGG orthology group: None (inferred from 70% identity to bsb:Bresu_0774)

MetaCyc: 52% identical to Mn2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-487

Predicted SEED Role

"protein of unknown function DUF204"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>MPMX19_06381 putative manganese efflux pump MntP (Azospirillum sp. SherDot2)
MTPLSIAVLSLSMSADAFAASIGRGASRRPNFPAALKGGLVFGAIEAVTPLIGWALGLAA
AGFVTAVDHWIAFALLGLVGGKMVWEGFQAQEDEGDAASRSNPWALVATAVGTSIDAAAV
GVSLAFLGTNIIVIALSIGFATFAMTTIGMMIGKAVGVRFGKVVEVLGGMALIGLGCSIL
VEHLGLIA