Protein Info for MPMX19_06345 in Azospirillum sp. SherDot2

Annotation: Pyruvate synthase subunit PorC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02175: 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
  • amino acids 1 to 182 (182 residues), 189.3 bits, E=2.6e-60
• PF01558: POR
  • amino acids 10 to 181 (172 residues), 132.7 bits, E=8e-43

Best Hits

KEGG orthology group: K00172, pyruvate ferredoxin oxidoreductase, gamma subunit [EC: 1.2.7.1] (inferred from 64% identity to app:CAP2UW1_2510)

Predicted SEED Role

"Pyruvate:ferredoxin oxidoreductase, gamma subunit (EC 1.2.7.1)" in subsystem Ketoisovalerate oxidoreductase or Pyruvate:ferredoxin oxidoreductase (EC 1.2.7.1)

MetaCyc Pathways

• pyruvate fermentation to acetate and lactate II (4/4 steps found)
• pyruvate fermentation to acetate I (3/3 steps found)
• pyruvate fermentation to acetate VI (3/3 steps found)
• pyruvate fermentation to acetate VII (3/3 steps found)
• pyruvate fermentation to ethanol III (3/3 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• pyruvate fermentation to acetone (4/5 steps found)
• pyruvate decarboxylation to acetyl CoA III (1/1 steps found)
• pyruvate fermentation to hexanol (engineered) (8/11 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• L-alanine degradation V (oxidative Stickland reaction) (1/2 steps found)
• pyruvate fermentation to acetate III (1/2 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (6/9 steps found)
• reductive glycine pathway of autotrophic CO₂ fixation (6/9 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• isopropanol biosynthesis (engineered) (3/5 steps found)
• reductive TCA cycle I (7/11 steps found)
• incomplete reductive TCA cycle (4/7 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• pyruvate fermentation to acetate and alanine (1/3 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (8/13 steps found)
• glycerol degradation to butanol (10/16 steps found)
• reductive TCA cycle II (7/12 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (4/8 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (11/18 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (3/9 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Butanoate metabolism
• Citrate cycle (TCA cycle)
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.1

Use Curated BLAST to search for 1.2.7.1

Protein Sequence (185 amino acids)

>MPMX19_06345 Pyruvate synthase subunit PorC (Azospirillum sp. SherDot2)
MFQVRIHGRGGQGAVTAAEMLSVAAFKEARHAQAFPSFGSERTGAPVVSFCRIADTEIRT
REPVSVPDGLIVLDPTLFHTVDIFQGLPETGYVLINSSRTFEELHIADFMKRFPPGHTHC
VPATELARQHVGRPLPNAALLGGFAAITGQIRIESVLAAIRETFPGAVGEANAKAAVAAY
EHCLA