Protein Info for MPMX19_06336 in Azospirillum sp. SherDot2

Annotation: putative oxidoreductase CzcO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00890: FAD_binding_2" amino acids 14 to 50 (37 residues), 23 bits, see alignment 1.9e-08 PF07992: Pyr_redox_2" amino acids 14 to 223 (210 residues), 31.6 bits, see alignment E=5.4e-11 PF01266: DAO" amino acids 14 to 56 (43 residues), 30 bits, see alignment 1.8e-10 PF13738: Pyr_redox_3" amino acids 16 to 203 (188 residues), 95 bits, see alignment E=2.3e-30 PF13450: NAD_binding_8" amino acids 17 to 52 (36 residues), 26.9 bits, see alignment 2.2e-09 PF13434: Lys_Orn_oxgnase" amino acids 81 to 194 (114 residues), 27.2 bits, see alignment E=9.8e-10 PF00743: FMO-like" amino acids 126 to 203 (78 residues), 48.7 bits, see alignment E=2e-16

Best Hits

KEGG orthology group: None (inferred from 63% identity to bmu:Bmul_5666)

MetaCyc: 60% identical to [arsenate oxidoreductase]-[AioE protein] oxidoreductase (Agrobacterium tumefaciens GW4)
1.20.98.-

Predicted SEED Role

"monooxygenase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>MPMX19_06336 putative oxidoreductase CzcO (Azospirillum sp. SherDot2)
MQTSTMSVPTGDVDVVVVGGGQAGLAVGYHLRRSGLSFIILDAEEAPGGAWRHAWQSLRL
FSPAAWSSLPGWQLAGNDQDYPSRDDILDYLARYEDRYELPVRRPVMVRAVERTDGDRLR
VVSDQGVWMARMVVSTTGTWRHPIIPSYPGQELFRGTQLHSSTYSEPAAFAGQCVLVVGG
GNSGAQILAELSKVAGTIWVTERPPAFLPDEVDGRELFRRATERVKALQEGRGEAVPAGG
FGDIVMVPPVVEARGRGVLHAVGRFSRFFDGGVEWADGTRSTVDAVIWCTGFRPALDHVA
GLGIIEENGTVALEGTRSLREPRLWFVGYGGWTGPASATLIGVGRSARDTARSLIDGLAA
SAH