Protein Info for MPMX19_06311 in Azospirillum sp. SherDot2

Annotation: Serine/threonine-protein kinase toxin HipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 TIGR03071: HipA N-terminal domain" amino acids 4 to 101 (98 residues), 66.7 bits, see alignment E=8.2e-23 PF13657: Couple_hipA" amino acids 5 to 101 (97 residues), 68.3 bits, see alignment E=7.2e-23 PF07804: HipA_C" amino acids 142 to 377 (236 residues), 173.7 bits, see alignment E=4.5e-55

Best Hits

KEGG orthology group: K07154, (no description) (inferred from 56% identity to acr:Acry_3372)

Predicted SEED Role

"HipA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (428 amino acids)

>MPMX19_06311 Serine/threonine-protein kinase toxin HipA (Azospirillum sp. SherDot2)
MSTLPVHYEHLVIGAITLADEGPSFAYDIRWQNTRGAFPVSLGMPLGGGPFGPEVLMPWL
ANLLPEDANLLAVGRNLGVAPQDVIGILERIGRDTAGALTIGRLRAGEAPDYRPIDGETE
LEKIIEELPAKPFLAGEDGVSMSLAGAQEKLPVALLPDGRMAIPVNGAPSTHILKPDARR
RLWGSVQNEALCMTLAHRCDLKTAAVTTGKAGERSYLLVTRYDRVQRDGRWLRVHQEDFC
QALGKPPGAKYERNRLGIKGPRLVDMFKVVDDHLTAADRMRLLDAVVFNVLICNTDAHAK
NYSILLTGRGASLAPLYDLMCAAAWENVTKNLSQTIAGKGRGDHLMGRHWQRMADECGFN
RTMILRRIETVADRVRRELPEAVGAVRAMPGGDHPLLGEFAAAIEARCRTVVRLLAHVEE
DAEDEHPR