Protein Info for MPMX19_06286 in Azospirillum sp. SherDot2

Annotation: Fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 209 to 248 (40 residues), see Phobius details amino acids 319 to 336 (18 residues), see Phobius details PF00487: FA_desaturase" amino acids 72 to 318 (247 residues), 121.7 bits, see alignment E=2.3e-39

Best Hits

KEGG orthology group: K10255, omega-6 fatty acid desaturase (delta-12 desaturase) [EC: 1.14.19.-] (inferred from 70% identity to azl:AZL_011320)

Predicted SEED Role

"Beta-carotene ketolase (EC 1.14.-.-)" in subsystem Carotenoids (EC 1.14.-.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.-.- or 1.14.19.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (347 amino acids)

>MPMX19_06286 Fatty acid desaturase (Azospirillum sp. SherDot2)
MTQDAVGATLPPHNDVAIGDGGHALLRERLRPYQTPNLVRSLAQLATSVLPFIGCWALMV
LSLDISYAVTLLLAVPAAGFLVRIFIIQHDCGHGAFFRSRRANDAIGTLCGVMTLTPYAN
WRRQHAGHHANWNNLDRRNSGYDIYSSCLTLDEYNALGHRERLFHRLLRYPVVALILLPP
LVFLVLYRFPFDTPSDWRQERLSVHKTNLMIAALLLTLAAWLGFGTVLLVQLPITILAAI
AGVWLFSVQHRFEHTLWVRQEQWEPQLAALQGSSYLRLSAILQWFTGNIGFHHIHHLNPR
IPNYHLQQCHRDIRALQEAPVLTLGGALAGGCLWLWDEARGKLVPFP