Protein Info for MPMX19_06239 in Azospirillum sp. SherDot2

Annotation: Transcriptional regulatory protein BtsR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF00072: Response_reg" amino acids 7 to 115 (109 residues), 96.5 bits, see alignment E=1.1e-31 PF04397: LytTR" amino acids 146 to 239 (94 residues), 67.4 bits, see alignment E=1.1e-22

Best Hits

Swiss-Prot: 61% identical to BTSR_ECOL6: Transcriptional regulatory protein BtsR (btsR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02477, two-component system, LytT family, response regulator (inferred from 94% identity to azl:AZL_e04050)

Predicted SEED Role

"Autolysis response regulater LytR" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (242 amino acids)

>MPMX19_06239 Transcriptional regulatory protein BtsR (Azospirillum sp. SherDot2)
MTAAMNVLIVDDEPLAREELRRLLEESSDIRIVGECANAIEAIGAINRQAPDVVFLDIQM
PRVSGLEMLSMLDPERMPRIVFLTAHDEYAVQAFEEHAFDYLLKPADPARLAKTLQRLRR
QHAPQELSVLPGAAELRHIPCTGVNRITLMKLADVEYVVSRPAGVYVVGEDGQERFTELT
LHTIQEKSPLFRCHRQHLVNPDRIREIRFADGGLAEIQTTGGHAVPVSRRFLGALKERLG
MG