Protein Info for MPMX19_06227 in Azospirillum sp. SherDot2

Annotation: L-arabinose 1-dehydrogenase (NAD(P)(+))

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF01408: GFO_IDH_MocA" amino acids 7 to 115 (109 residues), 59.1 bits, see alignment E=3.7e-20

Best Hits

Swiss-Prot: 51% identical to ARAA_AZOBR: L-arabinose 1-dehydrogenase (NAD(P)(+)) (araA) from Azospirillum brasilense

KEGG orthology group: K00035, D-galactose 1-dehydrogenase [EC: 1.1.1.48] (inferred from 90% identity to azl:AZL_e03690)

MetaCyc: 52% identical to galactose dehydrogenase (Sinorhizobium meliloti)
Galactose 1-dehydrogenase. [EC: 1.1.1.48]

Predicted SEED Role

"D-galactose 1-dehydrogenase (EC 1.1.1.48)" (EC 1.1.1.48)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>MPMX19_06227 L-arabinose 1-dehydrogenase (NAD(P)(+)) (Azospirillum sp. SherDot2)
MTLPTLGLVGLGKIARDQHIPAIAATGLFNLAAVVSPDGATVDGVPSFRSQSDMLAALPG
LDAVALCTPPAVRHGLTVEALRAGCHVLIEKPPAATLSELHDLAAEAETARRTLFTAWHS
QFNPAVEETKRRLADADIRSVAITWKEDVRRWHPGQDWIFAAGGFGVFDPGINALSILTD
ILPAPVFVRAADLHVPANCDTAIAATLEMGAAPGSRIGRVTADFDFLQQGEQTWSIVIET
ADGRLDLTHGGTRLFADGVPVLAEPDTEYQRIYRHFHRLIGDGASDVDGRPLSLVADACM
VGRWHRTDSFDW