Protein Info for MPMX19_06159 in Azospirillum sp. SherDot2

Annotation: N-carbamoyl-L-amino acid hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 TIGR01879: amidase, hydantoinase/carbamoylase family" amino acids 17 to 410 (394 residues), 414.7 bits, see alignment E=2e-128 PF04389: Peptidase_M28" amino acids 67 to 149 (83 residues), 25.7 bits, see alignment E=1.3e-09 PF01546: Peptidase_M20" amino acids 83 to 412 (330 residues), 84 bits, see alignment E=2.1e-27 PF07687: M20_dimer" amino acids 218 to 319 (102 residues), 23.5 bits, see alignment E=6.6e-09

Best Hits

KEGG orthology group: K02083, allantoate deiminase [EC: 3.5.3.9] (inferred from 94% identity to azl:AZL_e01540)

Predicted SEED Role

"N-carbamoyl-L-amino acid hydrolase (EC 3.5.1.87)" in subsystem Hydantoin metabolism (EC 3.5.1.87)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.87

Use Curated BLAST to search for 3.5.1.87 or 3.5.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (420 amino acids)

>MPMX19_06159 N-carbamoyl-L-amino acid hydrolase (Azospirillum sp. SherDot2)
MPDPLLSESQLSGPALLDRIDALAAISAEEGRLSRLYLTPEHRRANDLVAGWMREAGMSV
REDAVGNIVGRYEGDRPGLPALLIGSHLDTVRDAGRYDGMLGVLSGIAVAADLNAHGRRL
PFAVEVIGFGDEEGTRFQSTLIGSRAIAGTFDPAVLESRDAAGTRLADAMTAFGLDPAAW
ATAAYKADDVLAYAELHIEQGPVLEALGRPVGIVTAIAGATRLAVTVEGMAGHAGTVPMT
LRRDALAASAEMILAVEQLCSGQERLVGTVGRIEASPGATNVIAGKVRFTIDLRADRDPL
RLERVGAVRARLEAIADARGVAIGFETLHESPAVACHPALMAQFAAAAEAEGLDAPELPS
GAGHDAMAVAALTDIAMLFVRCERGISHNPAERITAADAEAGARVLARFVENFQPATSIP