Protein Info for MPMX19_06124 in Azospirillum sp. SherDot2

Annotation: Chloramphenicol acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 57 to 73 (17 residues), see Phobius details PF00132: Hexapep" amino acids 109 to 143 (35 residues), 39.3 bits, see alignment 3.3e-14 PF14602: Hexapep_2" amino acids 110 to 138 (29 residues), 27.3 bits, see alignment 2.4e-10

Best Hits

Swiss-Prot: 78% identical to CAT4_AGRFC: Chloramphenicol acetyltransferase (cat) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00638, chloramphenicol O-acetyltransferase [EC: 2.3.1.28] (inferred from 79% identity to pde:Pden_0116)

Predicted SEED Role

"Chloramphenicol acetyltransferase (EC 2.3.1.28)" (EC 2.3.1.28)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>MPMX19_06124 Chloramphenicol acetyltransferase (Azospirillum sp. SherDot2)
MKNFFESPFKGILLEKQVTNPNIVFGRYSYYSGYYHGHSFDDCARFLLPDEGADKLVIGS
FCSIGSGAAFIMAGNQGHRSDWISTFPFFWMPDVPAFAGAQNGYQPGGDTVIGNDVWIGS
EAIVMPGITIGDGAVIGTRSLVTRDVEPYAIVGGSPARTIRKRFDDQLVALLLEMTWWDW
SDDQLQSAMPILTSGDVAALHRHWESVIKRS