Protein Info for MPMX19_06111 in Azospirillum sp. SherDot2

Annotation: Non-motile and phage-resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR00229: PAS domain S-box protein" amino acids 44 to 168 (125 residues), 52.4 bits, see alignment E=2.8e-18 PF00989: PAS" amino acids 47 to 158 (112 residues), 38.1 bits, see alignment E=3.6e-13 PF08448: PAS_4" amino acids 57 to 163 (107 residues), 58.8 bits, see alignment E=1.5e-19 PF00512: HisKA" amino acids 213 to 282 (70 residues), 67.1 bits, see alignment E=2.9e-22 PF02518: HATPase_c" amino acids 328 to 439 (112 residues), 95.2 bits, see alignment E=8.3e-31

Best Hits

KEGG orthology group: K07716, two-component system, cell cycle sensor histidine kinase PleC [EC: 2.7.13.3] (inferred from 86% identity to azl:AZL_e02000)

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>MPMX19_06111 Non-motile and phage-resistance protein (Azospirillum sp. SherDot2)
MTNPTFFSGPGQPAGGGPADAVRWLERRIAELESALRQSEARAGEARFRSLLRTAASIIL
VLGDDGRIVEANRDAERAFGLEAGSAIGRLWAEAMREQPTGPFAAQLAVAAMGTEVRNFE
QVLREQDCMSERVLLWNLNRLPKADGASAGILCVGQDITRRKRAELALRQARDELEMRVA
ERTRALMQEVQERRRAEQALIQAKEQAELANRAKSEFLANMSHELRTPLNAIIGFSSMME
SEIVGPLGHPKYLDYAKVIGKSSQHLLAVISDILDVAKIEAGKLEMHPQPMDVRDAVESS
LLLIAERAEEGGLALSQDIAPDTPHLLGDPVRVKQILLNLLSNAVKFTPVGGSVALRVRP
EGDRILIEVADSGIGMSAEGIAIALQPFGQVDSQLSRRSGGTGLGLPLVRSFVDLLNGTL
DIRSREGEGTTVSVRLPVALPYDGE