Protein Info for MPMX19_05981 in Azospirillum sp. SherDot2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 57 to 74 (18 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 215 to 232 (18 residues), see Phobius details amino acids 237 to 253 (17 residues), see Phobius details amino acids 265 to 281 (17 residues), see Phobius details amino acids 287 to 304 (18 residues), see Phobius details amino acids 316 to 339 (24 residues), see Phobius details amino acids 354 to 377 (24 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 49 to 368 (320 residues), 94 bits, see alignment E=4.8e-31

Best Hits

KEGG orthology group: None (inferred from 75% identity to azl:AZL_e02940)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>MPMX19_05981 hypothetical protein (Azospirillum sp. SherDot2)
MAFSPLLAVFLFAVAICASWAILRLVPRPLRPQAGADSRNDGRTDGRYAAIDGMRGLLAY
AVFIHHGIITWQYLHTGLWTLPPSRLYTQLGQSSVALFFMVTAFLFWDKLLKAGPEMDWP
GFVSSRIYRVYPVYAVAVLLVAVLALASTGFEVRTGPLDLLRRLIGWATFKAPPINGLEN
TGQIVAYATWSLPYELLFYAALPALAFLVTPAHRLRPALVSVAATLILLLYFRNFSLAVL
ECFLGGIAAAHAIRRPGLVRFARSGRGLAVALAGLSAAVAGFDTAYAPLPVLGLGLFFVA
IAADQSFRGALTCQPVLWLGEISYGVYLLHGIVIWTTITANAPVRSLVGEDAGLYALALA
GTGILVVAVASLVHLAIERPAIMAGRRSRALRRNDRAERVPA