Protein Info for MPMX19_05964 in Azospirillum sp. SherDot2

Annotation: GMP reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 TIGR01305: guanosine monophosphate reductase" amino acids 8 to 354 (347 residues), 504.8 bits, see alignment E=5.5e-156 PF00478: IMPDH" amino acids 14 to 347 (334 residues), 237 bits, see alignment E=1.5e-74

Best Hits

Swiss-Prot: 62% identical to GUAC_VIBCM: GMP reductase (guaC) from Vibrio cholerae serotype O1 (strain M66-2)

KEGG orthology group: K00364, GMP reductase [EC: 1.7.1.7] (inferred from 95% identity to azl:AZL_e03110)

Predicted SEED Role

"GMP reductase (EC 1.7.1.7)" in subsystem Purine conversions (EC 1.7.1.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>MPMX19_05964 GMP reductase (Azospirillum sp. SherDot2)
MSRCAVIIESDLKLDFKDVLIRPKRSTLQSRNDVDVNRTFTFLHTQRDWTGFPLIAANMD
VTGSMGMARALSRFGAMTALHKHYKAEELADFFRAEAESATLSNVFYSMGIAEADHDKFL
AVKAKAPVGKICLDVANGYTERFVEVIARLRQENPDAVIMAGNVVTGDMTEALLLAGADI
VKVGIGPGSVCTTRKMTGVGYPQLSAIIECADAAHGLKGQVCGDGGCTVPGDISKAYGAG
ADFVMLGGMLAGHDECEGEIRYEDRDGNRVPVAMTFYGMSSDTAMHKYSGGVASYRASEG
KTVDVPYRGPVENTMQEIMGGVRSMMTYIGATRLKEVPKRTTFVRVGAQLNTVFGG